PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00041975-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 412aa    MW: 45356.5 Da    PI: 6.6955
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00041975-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-131055147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg+WT +Ed +l +++k +    W++Ia +++ gRt++++k++w++ 
  PSME_00041975-RA 10 RGPWTCDEDVRLTNYIKAHREAGWALIAGRIP-GRTDNEIKNYWNTN 55
                      89******************************.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.443160IPR017930Myb domain
SuperFamilySSF466897.48E-14765IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-17861IPR009057Homeodomain-like
SMARTSM007171.0E-10958IPR001005SANT/Myb domain
PfamPF002498.2E-121056IPR001005SANT/Myb domain
CDDcd001672.13E-91256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGRTPLALKR GPWTCDEDVR LTNYIKAHRE AGWALIAGRI PGRTDNEIKN YWNTNLSKKL  60
ISQGINPRTH KHFSEPQDKG SNSGEREASL KSQWENNTTI PARSIAERRA DHLQAMPSKG  120
GGAIAGHDNQ DDRASTAWPP LNNQFPQASL AYNPTPSASL AIHFLSRYSV IYSMTNAFQE  180
YTNYLLCFPG ILLHSTNTNN IGSKQSYFDP LMPCKAFRSS ARDGVGRYDF DQNLLKNPVT  240
SSNDMIASTV RLSSGLITAP FATQFKSSHA FLSGNALLNG KHAGMSSLQS LQDFETNPDS  300
SFIVNPYEEA DSHQLSHTSC VASEQNAAAC SCHYPIIPTV MGAALGDFNS DIFPSLLKSF  360
GNEELMQLEE GYSADTSIAQ NVQACLLNED KAENLTSYDL LTKLCRSSQY HP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LNN44e-99B8LNN4_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-19myb domain protein 6